ShopDreamUp AI ArtDreamUp
Deviation Actions
Daily Deviation
Daily Deviation
February 22, 2015
Legend of Zelda - Wii/WiiU/DS/etc Era by lucidsky
It's a loyal and faithful masterpiece worth of the years that told the tale of the Legend of Zelda, with impressive tones and magnificent enchanting vibe.
It's a loyal and faithful masterpiece worth of the years that told the tale of the Legend of Zelda, with impressive tones and magnificent enchanting vibe.
Featured by TheCreativeJenn
Suggested by FallenAngelGM
Fan Status+ NSFW Content
6 Subscribers
Show your fandom. ❤️ Get full access to all explicit content that I'm not allowed to post for free due to DeviantArt's content policies. Have some influence on the themes of art I make via exclusive Polls Full access to all explicit content
$8/month
Suggested Deviants
Suggested Collections
You Might Like…
Featured in Groups
linklegendsheiktriforcezeldazeldalinkzeldaocarinazeldaocarinaoftimezeldawindwakerlinklegendofzeldalinktwilightprincesszeldatwilightzeldatwilightprincesstriforcelinkraviosheikzeldatriforcezeldamidnatwilightzeldaskywardswordmidnatwilightprincesslinkskywardswordzeldaskywardlinkbetweenworldsraviolinkraviolengendofzelda
Description
Hello everyone! What started as a little doodle on a note card turned into this little gem here. A few of the newer titles are represented here as well as the "anime" style shown in the newer games. The textured motif and little fuzzy/snow bits/sparkles on the green background reminds me of the holidays. Hope everyone is having a good holiday season no matter what you're celebrating!
This will be available in two sizes in my online store which will be open for a short period of time. Standard is 13" x 19" and large is printed on a sexy photo metallic at 24" x 36".
squareup.com/market/lucidsky
This will be available in two sizes in my online store which will be open for a short period of time. Standard is 13" x 19" and large is printed on a sexy photo metallic at 24" x 36".
squareup.com/market/lucidsky
Image size
600x877px 851.94 KB
© 2014 - 2024 lucidsky
Comments156
Join the community to add your comment. Already a deviant? Log In
Beautiful!!!